- ERR gamma/NR3B3 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-91873
- Human
- This antibody was developed against Recombinant Protein corresponding to amino acids: SGSYSSTMNG HQNGLDSPPL YPSAPILGGS GPVRKLYDDC SSTIVEDPQT KCEYMLNSMP K
- 0.1 ml (also 25ul)
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- Unconjugated
- ERR gamma/NR3B3
- ERR-gamma, ERR3, ERRg, ERRgamma, NR3B3
- Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- estrogen related receptor gamma
- IgG
- Polyclonal
- Immunogen affinity purified
- Novus Biologicals, a Bio-Techne Brand
- Primary Antibodies
- Cancer, Endocrinology, Signal Transduction
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
SGSYSSTMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYMLNSMPK
Specifications/Features
Available conjugates: Unconjugated